PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn111201
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 986aa    MW: 110384 Da    PI: 7.7408
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn111201genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.61e-16701745147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
       Achn111201 701 RGRFSFEEEEAIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 745
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5085012.1641407IPR020846Major facilitator superfamily domain
CDDcd061742.08E-2728377IPR020846Major facilitator superfamily domain
SuperFamilySSF1034734.58E-3729413IPR020846Major facilitator superfamily domain
PRINTSPR001711.0E-213545IPR003663Sugar/inositol transporter
Gene3DG3DSA:1.20.1250.203.7E-1536159No hitNo description
PfamPF000833.9E-76150418IPR005828Major facilitator, sugar transporter-like
Gene3DG3DSA:1.20.1250.201.8E-16214408No hitNo description
PRINTSPR001711.0E-21223233IPR003663Sugar/inositol transporter
PROSITE patternPS002160267284IPR005829Sugar transporter, conserved site
PRINTSPR001711.0E-21320341IPR003663Sugar/inositol transporter
PRINTSPR001711.0E-21343355IPR003663Sugar/inositol transporter
Gene3DG3DSA:3.30.540.101.9E-19515657No hitNo description
SuperFamilySSF566554.45E-14515657No hitNo description
PROSITE profilePS500904.403657695IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.3E-10681708IPR009057Homeodomain-like
SuperFamilySSF466895.56E-21681753IPR009057Homeodomain-like
PROSITE profilePS5129425.563696750IPR017930Myb domain
SMARTSM007178.3E-17700748IPR001005SANT/Myb domain
PfamPF002496.5E-15701745IPR001005SANT/Myb domain
CDDcd001676.39E-12703746No hitNo description
Gene3DG3DSA:1.10.10.602.1E-21709747IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055085Biological Processtransmembrane transport
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0022891Molecular Functionsubstrate-specific transmembrane transporter activity
Sequence ? help Back to Top
Protein Sequence    Length: 986 aa     Download sequence    Send to blast
MPAAGFGPGP GNGKQYPGNL TLYVTVTCMV AAMGGLIFGY DIGISGGVTT MDSFLKKFFP  60
SVYEKQKADT STNQYCKFDS QTLTMFTSSL YLAALASSLV ASWVTRKLGR KLSMLFGGLL  120
FCAGALINGF AQKVWMLIVG RILLGFGIGF ANQTPNSMIE RDQREEARIK LKRIRGVEDI  180
EEEFNDLVAA SDASKKVEHP WRNLLQRKYR PHLTMAILIP FFQQLTGINV IMFYAPVLFK  240
TIGFGSDAAL MSAVITGVVN VSATLVSIYG VDKWGRRFLF LQGGVQMLIC QIVVAACIGA  300
KFGIDGEPGR LPKWYAIVVV LFICIYVAGF AWSWGPLGWL VPSEIFPLEI RSAAQSINVS  360
VNMIFTFIIA QVFLTMLCHL KFGLFIFFAF FVVVMTIFVY FFLPETKNIP IEEMVIVWKQ  420
HWFWSRFITD VDYPANGAVQ MGKGGDTCGR PCKAISAEVT PPPPNFPSMD LVQSAFRFPT  480
TPLLRRHPHR PLTPLRRLRF TIRSSLPFPE QTARYHRELR AAVDAVERAC RLCVDIKAMI  540
DFEFSNDFQV NKSLLSNDGR ILEKNDQTPV TVADFGVQAL ISLELSKLFP SIPLVAEEDS  600
AFLRSNSLVN SVVNEVTDKS SFGDKQLTEA DVLEAIDRGA KDAFSFGPKP ATYWVTDWRG  660
SELDLAADQV ERRIIFPSGL QRCGKSCRLR WTNYLRPDIK RGRFSFEEEE AIIQLHSILG  720
NKWSAIAARL PGRTDNEIKN YWNTHIRKRL LRMGIDPVTH NPRLDLLDLS SILSSSFYNP  780
SQMNLSRLLG VEPLVNPEIL RLATSLLSSH RENPNFLLQN VQESHLCNPQ EVQAQLPQLS  840
QTNQSQTLIQ EIPICTTLST PNCVPFARKA QIMEPNVNQF STDFTNFSEW QNNELPSNLS  900
KEYAQAPNFG YYGSENSNFQ SHNSNNFSFG SVLSTPSSSP TPLHSNSGYI NSSSTITTAT  960
EDEKESYCSM LNFEIPEMLN VNEFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4gby_A3e-30153419222479D-xylose-proton symporter
4gbz_A3e-30153419222479D-xylose-proton symporter
4gc0_A3e-30153419222479D-xylose-proton symporter
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX0675420.0JX067542.1 Actinidia deliciosa clone 1475738 hexose transport protein (SPT1) mRNA, complete cds.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.13e-66MYB-like 102